PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 185aa    MW: 19803 Da    PI: 6.5204
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24978genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.32e-5725120297
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk 
  Tp57577_TGAC_v2_mRNA24978  25 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKG 108
                                89********************************************************************************** PP

                      NF-YB  86 ylkkyrelegek 97 
                                yl+++re+egek
  Tp57577_TGAC_v2_mRNA24978 109 YLQRFREMEGEK 120
                                **********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-5519132IPR009072Histone-fold
SuperFamilySSF471131.76E-4027130IPR009072Histone-fold
PfamPF008084.9E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.3E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.3E-207795No hitNo description
PRINTSPR006153.3E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MADSDNDSGG PHGGSNAHGS EMSPREQDRF LPIANVSRIM KKALPANAKI SKDAKETVQE  60
CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMTTLGFE EYVEPLKGYL QRFREMEGEK  120
TVVARDKDAP QGSNSVNNSS FESGSYGGGI MMHQGHVYGS GGFQVIGKGG PGYPGPGSNP  180
GRPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-4822115194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4822115194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182851e-160JQ918285.1 Medicago truncatula nuclear transcription factor Y subunit B12 (NF-YB12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523242.11e-110PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233103e-75NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0L9VBC01e-111A0A0L9VBC0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S6N11e-111A0A0S3S6N1_PHAAN; Uncharacterized protein
STRINGGLYMA18G08620.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-76nuclear factor Y, subunit B3